Highlighted
Level 1: Cadet

Emails not being received

Hi, we are sending emails to our members and over the last couple of weeks, emails are being put in the member's spam box in Telstra mail so even if they are using another mail reader i.e Outlook they are not receiving their mail. this is only happening to members with big pond accounts. 

Below is a copy of the email information

 

Return-Path: <bounce-10077@m2.sendingservice.net>
Received: from extmail.bigpond.com ([10.10.26.4])
by viclafep36p-svc.bpe.nexus.telstra.com.au with ESMTP
id <20200326010822.DEYE31709.viclafep36p-svc.bpe.nexus.telstra.com.au@extmail.bigpond.com>
for <bmys@bigpond.com>; Thu, 26 Mar 2020 12:08:22 +1100
Received-SPF: pass (extmail.bigpond.com: domain m2.sendingservice.net
designates 176.9.183.138 as permitted sender) identity=mailfrom;
receiver=extmail.bigpond.com; client-ip=176.9.183.138;
envelope-from=bounce-10077@m2.sendingservice.net;
helo=mta138.sendingservice.net;
Received-SPF: none (extmail.bigpond.com: domain mta138.sendingservice.net does
not designate permitted sender hosts) identity=helo;
receiver=extmail.bigpond.com; client-ip=176.9.183.138;
helo=mta138.sendingservice.net;
X-RG-Spam: Suspect
X-RG-VS-CLASS: spam
X-RazorGate-Vade: gggruggvucftvghtrhhoucdtuddrgedugedrudehhedgvdejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuuffpveftpgfvgffnuffvtfetnecuuegrihhlohhuthemucegtddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenogevohgrshhtrghlqdfhgeduuddqvddtucdlfedttddmnefjrghmjfgvrgguvghrhfhivghlugcujfgvrgguvghrucfutghorhhinhhgucdlqddutddmnecujfgurhepfffhrhfvkffugggtgffjsegrqherredttdejnecuhfhrohhmpedfuefojgfuucfpvgifshcuqfhuthcuofgrihhlvghrucdlffhoucfpohhtucftvghplhihucfvohcuvfhhihhsucetuggurhgvshhsmddfuceomhgvmhgsvghrshgpmhgrihhlsegsmhihshdrtghomhdrrghuqeenucffohhmrghinhepsghmhihsrdgtohhmrdgruhenucfkphepudejiedrledrudekfedrudefkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopehmthgrudefkedrshgvnhguihhnghhsvghrvhhitggvrdhnvghtpdhinhgvthepudejiedrledrudekfedrudefkedpmhgrihhlfhhrohhmpeeosghouhhntggvqddutddtjeejsehmvddrshgvnhguihhnghhsvghrvhhitggvrdhnvghtqecuuefqffgjpeekuefkvffokffogfdprhgtphhtthhopeeosghmhihssegsihhgphhonhgurdgtohhmqecuqfftvefrvfeprhhftgekvddvnegsmhihshessghighhpohhnugdrtghomhdr
rghu
X-RazorGate-Vade-Verdict: spam 190
X-RazorGate-Vade-Classification: spam
Received: from mta138.sendingservice.net (176.9.183.138) by extmail.bigpond.com (5.8.418)
id 5E72B6B10290D35A for bmys@bigpond.com.au; Thu, 26 Mar 2020 12:08:20 +1100
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; s=s01; d=sendingservice.net;
h=Date:From:Reply-To:To:Message-IDSmiley Frustratedubject:Mime-Version:Content-Type:
Content-Transfer-Encoding:Feedback-ID:List-Unsubscribe;
bh=GGZz69lNV8ZWHIixw+rhNiYbDrpEDQwn6oO7D55e9ig=;
b=UrURqWLhP+OFo4HMUDVMhT/G1KP+TCmrCI6G4oRSj7aI86h328oswqI9/PcBqRtez+BayDa2nZh7
OFaAUNJGSYTBlVmnn8Vh2fRsf0U5UzU4g05mGOtlkjA2jwtWEAiQUDfHsSZJ1UdW1K+Q+ZkkGByB
GBWCemV9pB9wLktGpNE=
Date: Thu, 26 Mar 2020 01:08:15 +0000
From: "BMYS News Out Mailer (Do Not Reply To This Address)" <members_mail@bmys.com.au>
Reply-To: BMYS Members Mail <members_mail@bmys.com.au>
To: BMYS Office <bmys@bigpond.com.au>
Message-ID: <120cc28b-f7ba-44c8-991a-9b7073636716@sendingservice.net>
Subject: Letter To Members Re the Coronavirus (COVID-19)
Mime-Version: 1.0
Content-Type: multipart/alternative;
boundary="--==_mimepart_5e7c007fa9ae_4caf2af07caf240857726511e";
charset=UTF-8
Content-Transfer-Encoding: quoted-printable
X-RID: 78HZBQfeT4qDq0ReKuxW4Gozwp8/LS2EdB8T2RCAZ4ID08rpTV7u8RAuwFutNQ+MhVZ9wTF/ltulBQ48eXoari/ROtFbmV55uVsx68CcPUU=
X-Message-ID: 120cc28b-f7ba-44c8-991a-9b7073636716
X-UserID: 10077
Feedback-ID: 10077:mailpoet
List-Unsubscribe: <https://www.bmys.com.au?mailpoet_router&endpoint=track&action=click&data=WyIyIiwiY2UzMWU0IiwiMTMwIiw...>
X-Virtual-MTA: mta138

Was this helpful?

  • Yes it was, thank you
  • No, I still need help

Set it & forget it

With direct debit there’s no need to give paying your bill another thought.

Avoid queuing up and never worry about late fees again.

Setup direct debit